Physicochemical properties, indices and descriptors for amino-acid sequences.
peptides.py is a pure-Python package to compute common descriptors for
protein sequences. It started as a port of Peptides, the R package written by
Daniel Osorio, but now also provides
some additional features from EMBOSS,
ExPASy Protein Identification and Analysis Tools, and Rcpi.
This library has no external dependency and is available for all modern Python versions (3.6+).
A non-exhaustive list of available features:
- Peptide statistics: amino acid counts and frequencies.
- QSAR descriptors: BLOSUM indices, Cruciani properties, FASGAI vectors, Kidera factors, MS-WHIM scores, PCP descriptors, ProtFP descriptors, Sneath vectors, ST-scales, T-scales, VHSE-scales, Z-scales.
- Sequence profiles: hydrophobicity, hydrophobic moment, membrane position.
- Physicochemical properties: aliphatic index, instability index, theoretical net charge, isoelectric point, molecular weight (with isotope labelling support).
- Biological properties: structural class prediction.
If this library is missing a useful statistic or descriptor, feel free to reach out and open a feature request on the issue tracker of the project repository.
Most of the descriptors for a protein sequence are simple averages of values
taken in a lookup table, so computing them can be done in a vectorized manner.
If numpy can be imported, relevant functions
(like numpy.sum or numpy.take) will be used, otherwise a fallback
implementation using array.array
from the standard library is available.
Install the peptides package directly from PyPi
which hosts universal wheels that can be installed with pip:
$ pip install peptidesA complete API reference
can be found in the online documentation,
or directly from the command line using
pydoc:
$ pydoc peptides.PeptideStart by creating a Peptide object from a protein sequence:
>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")Then use the appropriate methods to compute the descriptors you want:
>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...Methods that return more than one scalar value (for instance, Peptide.blosum_indices)
will return a dedicated named tuple:
>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)Use the Peptide.descriptors method to get a dictionary with every available
descriptor. This makes it very easy to create a pandas.DataFrame with
descriptors for several protein sequences:
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5
0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500
1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000
2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333
[3 rows x 66 columns]Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.
Contributions are more than welcome! See
CONTRIBUTING.md
for more details.
This library is provided under the GNU General Public License v3.0.
The original R Peptides package was written by Daniel Osorio,
Paola Rondón-Villarreal and
Rodrigo Torres, and is licensed under
the terms of the GNU General Public License v2.0.
The EMBOSS applications are
released under the GNU General Public License v1.0.
This project is in no way not affiliated, sponsored, or otherwise endorsed
by the original Peptides authors. It was developed
by Martin Larralde during his PhD project
at the European Molecular Biology Laboratory in
the Zeller team.